Home > Product > Antimicrobial Peptides > Cycloviolacin Y5

Antimicrobial Peptides

Cycloviolacin Y5

[Price Inquiry]
CAT#
AF1903
Sequence
GIPCAESCVWIPCTVTAIVGCSCSDKVCYN
Host Chemicals
Viola philippica
Length
30
Activity
Antiviral
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.