Home > Product > Antimicrobial Peptides > lacticin Q

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

lacticin Q

[Price Inquiry]
CAT#
AF3302
Sequence
MAGFLKVVQLLAKYGSKAVQWAWANKGKILDWLNAGQAIDWVVSKIKQILGIK
Host Chemicals
Lactococcus lactis QU 5
Length
53
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.