Home > Product > Antimicrobial Peptides > ETD133

Antimicrobial Peptides

CAT#
AF3066
Sequence
DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANINCWCET
Host Chemicals
Synthetic construct
Length
44
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.