Home > Product > Antimicrobial Peptides > European bumblebee abaecin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

European bumblebee abaecin

[Price Inquiry]
CAT#
AF2768
Sequence
FVPYNPPRPYQSKPFPSFPGHGPFNPKIQWPYPLPNPGH
Host Chemicals
Bombus pascuorum
Length
39
Activity
Antimicrobial
SwissProt ID
P81463
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.