Exendins and Fragments

CAT#
E10002
Sequence
GEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
4186.7
Molecular Formula
C184H282N50O60S1
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.