Various Products/Alzheimer's Disease

warning All products are for research use only. Not for human use.

Galanin, human

[Price Inquiry]
CAT#
G01014
Sequence
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
M.W/Mr.
3157.5
Molecular Formula
C139H210N42O43
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.