Home > Product > Catalog Peptides > Others > Galanin Like Peptide, GALP, porcine

Others

Galanin Like Peptide, GALP, porcine

Price Inquiry
CAT#
G01020
Sequence
APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGIL
M.W/Mr.
6204.1
Length
42

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.