Home > Product > Antimicrobial Peptides > Gallinacin-6

Antimicrobial Peptides

Gallinacin-6

[Price Inquiry]
CAT#
AF2964
Sequence
SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA
Host Chemicals
Gallus gallus
Length
42
Activity
Antibacterial
SwissProt ID
Q6QLR3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.