CAT# | AF2964 |
Sequence | SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
Activity | Antibacterial |
Host Chemicals | Gallus gallus | Length | 42 | SwissProt ID | Q6QLR3 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF564 | Napin-like polypeptide | Inquiry | ||
AF2078 | Lebocin-1/2 precursor | Inquiry | ||
AF1969 | Odorranain-F-RA1 antimicrobial peptide | Inquiry | ||
AF2330 | Corticostatin-4 precursor | Inquiry | ||
AF537 | Macropin 2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...