Home > Product > Catalog Peptides > Others > Gastrin, chicken

Others

Gastrin, chicken

Price Inquiry
CAT#
G03020
Sequence
FLPHVFAELSDRKGFVQGNGAVEALHDFYPDWMDF-NH2
M.W/Mr.
4055.6
Molecular Formula
C190H265N47O51S1
Length
35

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.