Home > Product > Antimicrobial Peptides > Geobacillin I

Antimicrobial Peptides

Geobacillin I

[Price Inquiry]
CAT#
AF2329
Sequence
VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC
Host Chemicals
Geobacillus thermodenitrificans NG80-2
Length
33
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.