Glucagon-Like Peptide (GLP) II, human
Glucagon-Like Peptide (GLP) II, human
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreased apoptosis of enterocytes .
Online Inquiry
| CAT# | R1385 |
| CAS | 89750-15-2 |
| M.F/Formula | C₁₆₅H₂₅₄N₄₄O₅₅S |
| M.W/Mr. | 3766.20 |
| Sequence | One Letter Code: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
three Letter Code: His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Write a review
Ask a question
My Review for Glucagon-Like Peptide (GLP) II, human
Required fields are marked with *
×
Ask a Question for Glucagon-Like Peptide (GLP) II, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
