Home > Product > Antimicrobial Peptides > Gm apolipophoricin

Antimicrobial Peptides

Gm apolipophoricin

[Price Inquiry]
CAT#
AF3291
Sequence
VQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ
Host Chemicals
wax moth, Galleria mellonella
Length
51
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.