Home > Product > Antimicrobial Peptides > Harmoniasin

Antimicrobial Peptides

Harmoniasin

[Price Inquiry]
CAT#
AF3276
Sequence
SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ
Host Chemicals
Harmonia axyridis
Length
50
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.