Home > Product > Antimicrobial Peptides > Hedyotide B1

Antimicrobial Peptides

Hedyotide B1

[Price Inquiry]
CAT#
AF1947
Sequence
GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
Host Chemicals
Hedyotis biflora
Length
30
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.