Home > Product > Antimicrobial Peptides > HBD-26

Antimicrobial Peptides

CAT#
AF2968
Sequence
WYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKGRDCCVPAD
Host Chemicals
Homo sapiens
Length
42
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.