Home > Product > Antimicrobial Peptides > Hipposin

Antimicrobial Peptides

CAT#
AF3289
Sequence
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL
Host Chemicals
Atlantic halibut, Hippoglossus hippoglusus L
Length
51
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.