Home > Product > Antimicrobial Peptides > Human beta defensin 2

Antimicrobial Peptides

Human beta defensin 2

[Price Inquiry]
CAT#
AF2763
Sequence
DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPP
Host Chemicals
Homo sapiens
Length
39
Activity
Antibacterial
SwissProt ID
O15263
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.