Home > Product > Antimicrobial Peptides > Human beta defensin 4

Antimicrobial Peptides

Human beta defensin 4

[Price Inquiry]
CAT#
AF3252
Sequence
FELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Host Chemicals
skin, Homo sapiens
Length
49
Activity
Gram+ & Gram-, Chemotactic,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.