Home > Product > Antimicrobial Peptides > Kalata B9 linear

Antimicrobial Peptides

Kalata B9 linear

[Price Inquiry]
CAT#
AF2034
Sequence
GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
Host Chemicals
Oldenlandia affinis DC
Length
31
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.