Home > Product > Antimicrobial Peptides > Lantibiotic subtilin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Lantibiotic subtilin

[Price Inquiry]
CAT#
AF2168
Sequence
WKSESLCTPGCVTGALQTCFLQTLTCNCKISK
Host Chemicals
Bacillus subtilis
Length
32
Activity
Antibacterial
SwissProt ID
P10946
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.