Home > Product > Antimicrobial Peptides > LEAP-2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2845
Sequence
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
Host Chemicals
Homo sapiens
Length
40
Activity
Antibacterial
SwissProt ID
Q969E1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.