Home > Product > Antimicrobial Peptides > Lingual antimicrobial peptide

Antimicrobial Peptides

Lingual antimicrobial peptide

[Price Inquiry]
CAT#
AF2545
Sequence
SRRSCHRNKGVCALTRCPRNMRQIGTCFGPPVKCCR
Host Chemicals
Capra hircus
Length
36
Activity
Antimicrobial
SwissProt ID
Q0PGY0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.