Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide 2 precursor

Antimicrobial Peptides

Liver-expressed antimicrobial peptide 2 precursor

Price Inquiry
CAT#
AF2843
Sequence
MTPFWRGLSLRPLGASCRDASECLTKLCSKSRCSLKTFSN
Host Chemicals
Xenopus laevis
Length
40
Activity
Antimicrobial
SwissProt ID
L7V0G2

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.