Home > Product > Antimicrobial Peptides > Liver-expressed antimicrobial peptide 2 precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Liver-expressed antimicrobial peptide 2 precursor

[Price Inquiry]
CAT#
AF2843
Sequence
MTPFWRGLSLRPLGASCRDASECLTKLCSKSRCSLKTFSN
Host Chemicals
Xenopus laevis
Length
40
Activity
Antimicrobial
SwissProt ID
L7V0G2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.