Keywords Search Google Search Search

Manduca Sexta Moricin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2938
Sequence	GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF400	Mastoparan-V2	Inquiry
AF2833	Cecropin-A1/A2	Inquiry
AF2546	Granulosusin-C1 antimicrobial peptide precursor	Inquiry
AF517	Temporin-1TGc	Inquiry
AF2736	CRS4C-2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

Function of R8-T198wt in prostate cancer

The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...

The effect of Sincalide on gastric movement

Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

Function of phosphoramidon as an endothelin converting enzyme inhibitor

Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Manduca sexta
Length	42
SwissProt ID	Q86MA1