Home > Product > Antimicrobial Peptides > Manduca Sexta Moricin

Antimicrobial Peptides

Manduca Sexta Moricin

[Price Inquiry]
CAT#
AF2938
Sequence
GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH
Host Chemicals
Manduca sexta
Length
42
Activity
Antibacterial
SwissProt ID
Q86MA1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.