A potent and specific KV1.3 channel blocker, and exhibits no effect at calcium-activated channels. Margatoxin can reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.
CAT# | R0995 |
CAS | 145808-47-5 |
Synonyms/Alias | MgTX |
M.F/Formula | C178H286N52O50S7 |
M.W/Mr. | 4178.96 |
Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bridge between Cys7 and Cys29, Cys13 and Cys34, Cys17 and Cys36) |
Labeling Target | KV1.3 channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...