Home > Product > Catalog Peptides > Others > Nesfatin-1 (human)

Others

Nesfatin-1 (human)

[Price Inquiry]
CAT#
N01002
Sequence
VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGR
M.W/Mr.
9551.87
Molecular Formula
C427H691N113O134
Length
63
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.