Home > Product > Catalog Peptides > Others > Nesfatin-1 (rat)

Others

Nesfatin-1 (rat)

[Price Inquiry]
CAT#
N01001
Sequence
VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGR
M.W/Mr.
9582.80
Molecular Formula
C424H684N116O136
Length
63
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.