Keywords Search Google Search Search

Neuropeptide Y (2-36) (human, rat)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	N05013
M.F/Formula	C180H276N54O55S1
M.W/Mr.	4108.6
Sequence	PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

CAT#	Product Name	Inquiry
N05015	Pancreatic Polypeptide Fragment 1-17-[Ala31, alpha-Aminoisobutryl32]-Neuropeptide Y Fragment 18-36	Inquiry
N05037	Biotinyl-Neuropeptide Y (human, rat)	Inquiry
N05012	Neuropeptide Y (2-36) (porcine)	Inquiry
N05027	Neuropeptide Y, free acid, human, rat	Inquiry
N05034	(D-Trp32)-Neuropeptide Y (porcine)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Cyclotraxin B, A Selective Antagonist of TrkB Receptors

Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...

Palmitoyl Hexapeptide-12, a natural powerful antiager

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

Function of Psalmotoxin 1 in against pain

Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: