Home > Product > Catalog Peptides > Others > Neuropeptide Y (2-36) (human, rat)

Others

Neuropeptide Y (2-36) (human, rat)

[Price Inquiry]
CAT#
N05013
Sequence
PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
M.W/Mr.
4108.6
Molecular Formula
C180H276N54O55S1
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.