Home > Product > Catalog Peptides > Others > Neuropeptide Y, free acid, human, rat

Others

Neuropeptide Y, free acid, human, rat

[Price Inquiry]
CAT#
N05027
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
M.W/Mr.
4272.7
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.