Home > Product > Antimicrobial Peptides > Neutrophil beta defensin 5

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Neutrophil beta defensin 5

[Price Inquiry]
CAT#
AF2840
Sequence
LLVLLFLVLSAGSGFTQGVGNPVAVLGIKASVCRAGALET
Host Chemicals
Bubalus bubalis
Length
40
Activity
Antimicrobial
SwissProt ID
C7E000
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.