Home > Product > Antimicrobial Peptides > Neutrophil defensin 3

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Neutrophil defensin 3

[Price Inquiry]
CAT#
AF1865
Sequence
ACYCRIPACLAGERRYGTCFYRRRVWAFCC
Host Chemicals
Macaca mulatta
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P60031
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.