Keywords Search Google Search Search

Ns-D1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3263
Sequence	KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKPPAHRCICYYEC
Activity	Gram+ & Gram-, Fungi,

CAT#	Product Name	Inquiry
AF2394	Esculentin-2LTb-SN1 antimicrobial peptide precursor	Inquiry
AF1761	Odorranain-F1 antimicrobial peptide	Inquiry
AF1395	EC-hepcidin3	Inquiry
AF937	Nigrocin-2JDb	Inquiry
AF1427	Maximin-y	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Aviptadil Acetate on the Treatment of Pulmonary Arterial Hypertension

Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...

Function of spadin in neurological treatment of depression

Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...

What is Glutathione?

Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...

Function of dulaglutide in type 2 diabetes

Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...

PBP 10, a highly specific FPR2 antagonist

PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	seeds, Nigella sativa L.
Length	50