Home > Product > Antimicrobial Peptides > Omwaprin

Antimicrobial Peptides

CAT#
AF3261
Sequence
KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG
Host Chemicals
venom, Oxyuranus microlepidotus
Length
50
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.