PACAP (6-38), human, ovine, rat TFA
PACAP (6-38), human, ovine, rat TFA
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
Online Inquiry
| CAT# | R1594 |
| M.F/Formula | C₁₈₄H₃₀₁N₅₆FO₄₇S |
| M.W/Mr. | 4138.76 |
| Sequence | One Letter Code: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
three Letter Code: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
Write a review
Ask a question
My Review for PACAP (6-38), human, ovine, rat TFA
Required fields are marked with *
×
Ask a Question for PACAP (6-38), human, ovine, rat TFA
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
