CAT# | AF2180 |
Sequence | GFFAFIPKIISSPLFKTLLSAVGSALSSSGEQE |
Activity | Antimicrobial |
Host Chemicals | Pardachirus pavoninus | Length | 33 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2259 | Dermaseptin PD-3-3 | Inquiry | ||
AF383 | Antifungal lectin AMML | Inquiry | ||
AF2024 | Palustrin-OG1 antimicrobial peptide | Inquiry | ||
AF3014 | Mundticin | Inquiry | ||
AF1008 | Nigrocin-2VB | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...