Antimicrobial Peptides

CAT#
AF3254
Sequence
GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC
Host Chemicals
petals, Petunia hybrida
Length
49
Activity
Fungi,
SwissProt ID
Reference ID: AF507976

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.