Home > Product > Antimicrobial Peptides > Pilosulin 5

Antimicrobial Peptides

Pilosulin 5

[Price Inquiry]
CAT#
AF2568
Sequence
DVKGMKKAIKGILDCVIEKGYDKLAAKLKKVIQQLWE
Host Chemicals
Myrmecia pilosula
Length
37
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.