Home > Product > Catalog Peptides > Various Products / Diabetes > Preptin, Human Pro-Insulin Growth Factor II (67-100), mouse

Various Products / Diabetes

Preptin, Human Pro-Insulin Growth Factor II (67-100), mouse

[Price Inquiry]
CAT#
I02008
Sequence
DVSTSQAVLPDDFPRYPVGKFFQYDTWRQSAGRL
M.W/Mr.
3948.4
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.