CAT# | N1951 |
CAS | 423206-00-2 |
M.F/Formula | C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃ |
M.W/Mr. | 8792.55 |
Sequence | One Letter Code: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK three Letter Code: H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH trifluoroacetate salt (Disulfide bonds, air oxidized) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...