Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
Online Inquiry
| CAT# | N1951 |
| CAS | 423206-00-2 |
| M.F/Formula | C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃ |
| M.W/Mr. | 8792.55 |
| Sequence | One Letter Code: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
three Letter Code: H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH trifluoroacetate salt (Disulfide bonds, air oxidized) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
Required fields are marked with *
×
Ask a Question for Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
