Home > Product > Catalog Peptides > Others > Prolactin-Releasing Peptide (1-31), rat

Others

Prolactin-Releasing Peptide (1-31), rat

[Price Inquiry]
CAT#
P13001
Sequence
SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
M.W/Mr.
3594.04
Molecular Formula
C156H242N54O43S
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.