Home > Product > Catalog Peptides > Others > protease inhibitor PI-8

Others

protease inhibitor PI-8

[Price Inquiry]
CAT#
P15005
Sequence
QVNCTPGTTFKDKCNTCRCSSNGRSAACTLKACPPGSY
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.