Home > Product > Catalog Peptides > Others > protease inhibitor PI-3

Others

warning All products are for research use only. Not for human use.

protease inhibitor PI-3

[Price Inquiry]
CAT#
P15012
Sequence
AGECTPGQTKKQDCNTCTCTPTGIWGCTRKACRTTREAEEPAIV
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.