Home > Product > Antimicrobial Peptides > Royalisin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3292
Sequence
VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF
Host Chemicals
royal jelly honeybee, Apis mellifera L.
Length
51
Activity
Gram+,
SwissProt ID
SwissProt ID: P17722
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.