CAT# | AF3266 |
Sequence | KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |
Activity | Fungi, |
Host Chemicals | S alba | Length | 50 | SwissProt ID | SwissProt ID: P30231 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1088 | AR-23 | Inquiry | ||
AF2449 | Beta-defensin 8 | Inquiry | ||
AF2117 | Brevinin-2-RA12 peptide precursor | Inquiry | ||
AF1305 | Brevinin-1Ya | Inquiry | ||
AF2021 | Ranatuerin-2PRa precursor | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...
Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...
Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...