Home > Product > Antimicrobial Peptides > Sa-AFP1

Antimicrobial Peptides

CAT#
AF3266
Sequence
KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Host Chemicals
S alba
Length
50
Activity
Fungi,
SwissProt ID
SwissProt ID: P30231
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.