(Ser8)-GLP-1 (7-36), amide, human
(Ser8)-GLP-1 (7-36), amide, human
Online Inquiry
| CAT# | G16003 |
| M.F/Formula | C149H225N40O46 |
| M.W/Mr. | 3312.7 |
| Sequence | SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G16033 |
(Asp28)-Glucagon (1-29) (human, rat, porcine) |
|
|
Inquiry |
| G16011 |
([13C6]Leu14)-Glucagon (1-29) (human, rat, porcine) |
|
|
Inquiry |
| G16021 |
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) |
|
|
Inquiry |
| G05002 |
Glucagon (19-29), human |
|
|
Inquiry |
| G16008 |
GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human |
|
|
Inquiry |
Write a review
Ask a question
My Review for (Ser8)-GLP-1 (7-36), amide, human
Required fields are marked with *
×
Ask a Question for (Ser8)-GLP-1 (7-36), amide, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
