Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > (Ser8)-GLP-1 (7-36), amide, human

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

(Ser8)-GLP-1 (7-36), amide, human

[Price Inquiry]
CAT#
G16003
Sequence
SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
M.W/Mr.
3312.7
Molecular Formula
C149H225N40O46
Length
29
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.