Home > Product > Antimicrobial Peptides > Sperm associated antigen 11 isoform E

Antimicrobial Peptides

Sperm associated antigen 11 isoform E

[Price Inquiry]
CAT#
AF2535
Sequence
RNIICLMQHGTCRLFFCRSGEKKSEICSDPWNRCCI
Host Chemicals
Bos taurus
Length
36
Activity
Antibacterial
SwissProt ID
A4UAF2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.