Home > Product > Antimicrobial Peptides > Tachystatin A

Antimicrobial Peptides

Tachystatin A

Price Inquiry
CAT#
AF2863
Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGSYFPGSTYGRCQRP
Host Chemicals
Tachypleus tridentatus
Length
40
Activity
Antibacterial, Antifungal

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.