Home > Product > Antimicrobial Peptides > Tachystatin A

Antimicrobial Peptides

Tachystatin A

[Price Inquiry]
CAT#
AF2863
Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGSYFPGSTYGRCQRP
Host Chemicals
Tachypleus tridentatus
Length
40
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.