Home > Product > Catalog Peptides > Others > Tamulustoxin

Others

Tamulustoxin

[Price Inquiry]
CAT#
T18001
Sequence
RCHFVVCTTDCRRNSPGTYGECVKKEKGKECVCKS
Modifications
Disulfide bond(3)
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.