Home > Product > Antimicrobial Peptides > Thermophilin 9

Antimicrobial Peptides

Thermophilin 9

[Price Inquiry]
CAT#
AF2446
Sequence
LSCDEGMLAVGGLGAVGGPWGAAVGVLVGAALYCF
Host Chemicals
Streptococcus thermophilus LMD-9
Length
35
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.