Home > Product > Antimicrobial Peptides > THP-2

Antimicrobial Peptides

CAT#
AF2510
Sequence
LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
Host Chemicals
Meleagris gallopavo
Length
36
Activity
Antibacterial
SwissProt ID
P80392
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.